HORDB

ID: hor005960
Uniprot ID: P21857
Protein name: Urophysin
Gene name: NA
Organism: Platichthys flesus (European flounder) (Pleuronectes flesus)
Family: Urotensin-2 family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Platichthys (genus), Pleuronectidae (family), Pleuronectoidei (suborder), Pleuronectiformes (order), Carangaria , Percomorphaceae , Euacanthomorphacea , Acanthomorphata , Ctenosquamata , Eurypterygia , Neoteleostei , Euteleosteomorpha (cohort), Clupeocephala , Osteoglossocephalai , Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0005179 hormone activity
GO BP: GO:0007165 signal transduction; GO:0008217 regulation of blood pressure; GO:0097746 blood vessel diameter maintenance
GO CC: GO:0005576 extracellular region

Sequence: HPITESAEMPYPGPASLEERGVGSLDDLSLSEQNYPPQRGAGLRYATL
Length: 48
Propeptide: HPITESAEMPYPGPASLEERGVGSLDDLSLSEQNYPPQRGAGLRYATLEVLLEKQSLLNPFSRVFGIRKQFAGTTECFWKYCV
Signal peptide: NA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Urotensin is found in the teleost caudal neurosecretory system. It has a suggested role in osmoregulation and as a corticotropin-releasing factor. The non-hormonal portion of this precursor may be a urotensin binding protein, urophysin.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor005960_AF2.pdb

hor005960_ESM.pdb

Mass:	601018	Formula:	C225H350N62O76S
Absent amino acids:	CFKW	Common amino acids:	LP
pI:	4.22	Basic residues:	4
Polar residues:	16	Hydrophobic residues:	12
Hydrophobicity:	-66.67	Boman Index:	-8842
Half-Life:	3.5 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	71.25
Instability Index:	5866.67	Extinction Coefficient cystines:	4470
Absorbance 280nm:	95.11